PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YC
Protein Properties Length: 202aa    MW: 22599.7 Da    PI: 10.3012
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890660.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC461.2e-1493184899
           NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                     +++ +++d k +++P+ rik+i+++++   +is+ea  l+ ka e f+ ++   s++ + + ++++l    ++++v +  ++dfl d vp++
  XP_015890660.1  93 EEVAEKEDAKMNKFPMDRIKRIIRSEDSNLRISSEAIFLVNKATEKFLEKFCADSYVCCVQDRKKSLGYKHLSSIVCKRRKYDFLSDFVPEK 184
                     5678899**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.64E-16100183IPR009072Histone-fold
PfamPF008081.3E-14105166IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.8E-21106183IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MASSKKPVQE KKGNETKKKV TEGNSGKKGR NETNSSKTCN GTVSNSKIVP LQSSSSESQH  60
KVEDGPEITK TPTSSSKSRK GKGQQKVKRE REEEVAEKED AKMNKFPMDR IKRIIRSEDS  120
NLRISSEAIF LVNKATEKFL EKFCADSYVC CVQDRKKSLG YKHLSSIVCK RRKYDFLSDF  180
VPEKLKAEDA LAVAKLTKSE AG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1418KKPVQEKKGNETKKK
2154172RKKSLGYKHLSSIVCKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890660.11e-145PREDICTED: DNA polymerase epsilon subunit 4
TrEMBLM5W7G17e-52M5W7G1_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s01750.11e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-32nuclear factor Y, subunit C10